PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004512095.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 194aa    MW: 22891.7 Da    PI: 10.6468
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004512095.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.54.7e-30959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k ien +nrqvt+skRrngi+KKA+ELSvLCda+v++i+fs+++k++ey++
  XP_004512095.1  9 KLIENPTNRQVTYSKRRNGIFKKAHELSVLCDAKVSLIMFSKNNKMHEYIT 59
                    569**********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.5E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.469161IPR002100Transcription factor, MADS-box
CDDcd002658.80E-38277No hitNo description
SuperFamilySSF554558.63E-35296IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-27323IPR002100Transcription factor, MADS-box
PfamPF003192.5E-251157IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-273859IPR002100Transcription factor, MADS-box
PfamPF014862.5E-1883172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.04785178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MGRGKIEIKL IENPTNRQVT YSKRRNGIFK KAHELSVLCD AKVSLIMFSK NNKMHEYITP  60
GLSTKKIIDQ YQKTVGDIDL WRSHYEKMLE NLKKLKDINN KLRRQIRHRI GEGGLELDDL  120
SFQQLRSLED DMVSSIAKIR DRKFHVIKTR TDTCRKKVRS LEQMNGNLLL ELERRNHWRT  180
VHPPCMHSVT TILI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-15162162Myocyte-specific enhancer factor 2B
1tqe_Q4e-15162162Myocyte-specific enhancer factor 2B
1tqe_R4e-15162162Myocyte-specific enhancer factor 2B
1tqe_S4e-15162162Myocyte-specific enhancer factor 2B
3mu6_A2e-15262161Myocyte-specific enhancer factor 2A
3mu6_B2e-15262161Myocyte-specific enhancer factor 2A
3mu6_C2e-15262161Myocyte-specific enhancer factor 2A
3mu6_D2e-15262161Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN4120970.0JN412097.1 Medicago truncatula MADS-box transcription factor TM6 (TM6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004512095.11e-142PREDICTED: floral homeotic protein DEFICIENS-like isoform X3
SwissprotP237062e-70DEFA_ANTMA; Floral homeotic protein DEFICIENS
TrEMBLI1J8P41e-123I1J8P4_SOYBN; Uncharacterized protein
STRINGGLYMA01G37470.11e-112(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.17e-56MIKC_MADS family protein